B7-33 Peptide – Advanced Relaxin Mimetic for Cardiovascular & Anti-Fibrotic Research
B7-33 Peptide (Relaxin Mimetic) – RXFP1 Agonist Research Compound
B7-33 is a synthetic single-chain peptide analogue of human relaxin-2 (H2 relaxin), developed as a minimal potent derivative of the native peptide hormone . Unlike native H2 relaxin, which features a complex two-chain, three-disulfide-bond structure that is difficult and costly to synthesize, B7-33 maintains the organ-protective effects of relaxin in a simplified format . It functions as a selective agonist of the Relaxin Family Peptide Receptor 1 (RXFP1), preferentially activating the pERK signaling pathway over cAMP in cells natively expressing RXFP1 . This research-grade peptide is strictly for laboratory investigation and is not intended for human consumption.
Key Factual Details
| Attribute | Detail |
|---|---|
| Chemical Name | B7-33 Peptide (Relaxin B-chain-only analogue) |
| Sequence | Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH₂ |
| Sequence Shortening | VIKLSGRELVRAQIAISGMSTWSKRSL-NH₂ |
| Molecular Formula | C₁₃₁H₂₂₉N₄₁O₃₆S |
| Molecular Weight | ~2,986.54 g/mol |
| CAS Number | 1818415-56-3 |
| Purity | ≥95% (HPLC verified) |
| Classification | Relaxin mimetic / RXFP1 receptor agonist / Anti-fibrotic peptide |
Mechanism of Action & Research Applications
Selective RXFP1 Receptor Agonist: B7-33 binds to RXFP1, which is the primary receptor for human relaxin-2, and preferentially activates the pERK pathway without inducing significant cAMP signaling activation . This biased agonism replicates the beneficial effects of native relaxin while potentially avoiding pathways associated with tumorigenesis .
Anti-Fibrotic Activity: The peptide significantly modulates profibrotic gene expression, showing greater downregulation of Collagen Type I α-1 Chain (COL1A1) than reference anti-fibrotic agents, while maintaining biocompatibility with normal fibroblasts .
Cardioprotective Effects: B7-33 equivalently reduces left ventricular fibrosis, normalizes inflammation and cardiomyocyte hypertrophy, and restores blood vessel density and aortic contractility in experimental models of cardiomyopathy, matching the protective effects of native relaxin .
Research Applications:
-
Cardiovascular Research: Investigating heart failure, myocardial infarction, and vascular dysfunction
-
Fibrosis Research: Exploring hypertrophic scar management, organ fibrosis, and TGF-β/Smad pathway modulation
-
Preeclampsia Models: Evaluating therapeutic potential in hypertensive pregnancy disorders
-
Drug Delivery Systems: Investigating electrospun peptide-based dressings and controlled release formulations
Research Parameters
All dosages are for in-vitro and preclinical research use only and are not intended for human consumption.
In Vitro Research Concentrations :
-
Fibroblast viability studies: 0.03–0.3 μg/mL (72-hour exposure)
-
Gene expression modulation: 298.7 ng/mL
-
Controlled release dressings: 1.5% w/w loading
Preclinical Animal Dosing :
-
Cardiomyopathy model (mouse): 0.25 mg/kg/day, subcutaneous
-
Preeclampsia model (rat): 35 μg, intraperitoneal biweekly from gestation day 10-20
-
RUPP model (rat): Twice weekly intravenous from gestation day 10-20
Storage:
-
Store lyophilized powder at -20°C
-
Protect from light and moisture
Order B7-33 Today – Request a quote for your cardiovascular or anti-fibrotic research project. Available in various pack sizes with Certificate of Analysis. Contact our sales team for bulk pricing and custom synthesis inquiries.















Reviews
There are no reviews yet.